Skip to Content
Merck
All Photos(8)

Key Documents

AMAB90859

Sigma-Aldrich

Monoclonal Anti-MCL1 antibody produced in mouse

Prestige Antibodies® Powered by Atlas Antibodies, clone CL1128, purified immunoglobulin, buffered aqueous glycerol solution

Synonym(s):

BCL2L3, Mcl-1

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
€407.00

€407.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
€407.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

€407.00


Please contact Customer Service for Availability

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

CL1128, monoclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 1 μg/mL
immunofluorescence: 2-10 μg/mL (Fixation/Permeabilization: PFA/Triton X-100)
immunohistochemistry: 1:500- 1:1000

isotype

IgG1

Ensembl | human accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MCL1(4170)

General description

Induced myeloid leukemia cell differentiation protein (Mcl-1) belongs to B-cell lymphoma 2 (Bcl-2) apoptotic protein family. The Mcl-1 gene is mapped to human chromosome 1q21. It encodes a protein of 42 kDa. The alternate spliced variant is a small protein of 30 kDa. It contains three Bcl-2 homology (BH) domains whereas the alternate spliced has only one BH domain.

Immunogen

myeloid cell leukemia sequence 1 (BCL2-related), recombinant protein epitope signature tag (PrEST)

Sequence
DAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDG

Epitope
Binds to an epitope located within the peptide sequence PEEELDGYEP as determined by overlapping synthetic peptides.

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Induced myeloid leukemia cell differentiation protein (Mcl-1) functions as anti-apoptotic protein. Mcl-1 is upregulated in several carcinomas and is a key factor contributing to drug resistance in chemotherapies. It favors tumorigenesis in multiple myeloma and plays a crucial role in tumor progression. Spliceosome based inhibitors for Mcl-1 are suggested for prevent cancer metastasis.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70113

Physical form

Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Mcl-1; the molecular regulation of protein function
Thomas LW, et al.
Febs Letters, 584(14), 2981-2989 (2010)
Regulation of apoptosis and cell cycle progression by MCL1: Differential role of PCNA
Fujise K, et al.
The Journal of Biological Chemistry, 129(10), 2497-2506 (2000)
Mcl-1 regulation and its role in multiple myeloma
Gouill SL, et al.
Cell Cycle, 3(10), 1259-1262 (2004)
Regulation of Mcl-1 by SRSF1 and SRSF5 in cancer cells
Gautrey HL and Tyson-Capper AJ
PLoS ONE, 7(12), e51497-e51497 (2012)
Modification of alternative splicing of Mcl-1 pre-mRNA using antisense morpholino oligonucleotides induces apoptosis in basal cell carcinoma cells
Shieh JJ, et al.
The Journal of Investigative Dermatology, 129(10), 2497-2506 (2009)

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service