Skip to Content
Merck
All Photos(2)

Documents

WH0006334M4

Sigma-Aldrich

Monoclonal Anti-SCN8A antibody produced in mouse

clone 4G7, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-MED, Anti-Nav1.6, Anti-sodium channel, voltage gated, type VIII, alpha

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

4G7, monoclonal

form

buffered aqueous solution

species reactivity

rat, mouse, human

technique(s)

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SCN8A(6334)

General description

Sodium voltage-gated channel αsubunit 8 (SCN8A) is expressed in the central nervous system. The protein is specifically expressed in the axonal initial segment (AIS) and the nodes of Ranvier of myelinated axons. The gene encoding SCN8A is localized on human chromosome 12q13.13.

Immunogen

SCN8A (NP_055006, 1854 a.a. ~ 1951 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLARRGFICKKTTSNKLENGGTHREKKESTPSTASLPSYDSVT

Biochem/physiol Actions

Sodium voltage-gated channel αsubunit 8 (SCN8A) has a role in the generation and conduction of action potential. Mutations in the SCN8A gene have been associated with early infantile epileptic encephalopathy type 13.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

SCN8A mutations in Chinese patients with early onset epileptic encephalopathy and benign infantile seizures.
Wang J
BMC Medical Genetics, 18(1), 104-104 (2017)
Sodium channel SCN8A (Nav1.6): properties and de novo mutations in epileptic encephalopathy and intellectual disability.
O'Brien JE and Meisler MH
Frontiers in Genetics (2013)
Muhammad M Hossain et al.
Experimental neurology, 308, 111-119 (2018-07-19)
Parkinson's disease (PD), the second most common age-related progressive neurodegenerative disorder, is characterized by dopamine depletion and the loss of dopaminergic (DA) neurons with accompanying neuroinflammation. Zonisamide is an-anti-convulsant drug that has recently been shown to improve clinical symptoms of
Xiujie Li et al.
British journal of pharmacology, 178(17), 3553-3569 (2021-04-23)
Microglia-related inflammation is associated with the pathology of Parkinson's disease. Functional voltage-gated sodium channels (VGSCs) are involved in regulating microglial function. Here, we aim to investigate the effects of scorpion venom heat-resistant synthesized peptide (SVHRSP) on 6-hydroxydopamine (6-OHDA)-induced Parkinson's disease-like
AQP4 Aggravates Cognitive Impairment in Sepsis-Associated Encephalopathy through Inhibiting Nav 1.6-Mediated Astrocyte Autophagy.
Zhu, et al.
Advanced science (Weinheim, Baden-Wurttemberg, Germany), 10, e2205862-e2205862 (2023)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service