AV54576
Anti-GCLC antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-GCS, Anti-GLCL, Anti-GLCLC, Anti-Glutamate-cysteine ligase, catalytic subunit
Sign Into View Organizational & Contract Pricing
All Photos(3)
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
Pricing and availability is not currently available.
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
73 kDa
species reactivity
human, dog, rat, mouse, bovine, guinea pig, rabbit
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... GCLC(2729)
Related Categories
Immunogen
Synthetic peptide directed towards the N terminal region of human GCLC
Application
Anti-GCLC antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions
GCLC gene encodes the heavy catalytic subunit of the enzyme glutamate-cysteine ligase, which is the rate limiting enzyme of glutathione synthesis. Mutation at this locus is associated with hemolytic anemia due to deficiency of γ-glutamylcysteine synthetase. Polymorphism in GCLC subunit is found to be associated with sulfamethoxazole-induced hypersensitivity in HIV/AIDS patients in a study. A GAG-trinucleotide repeat polymorphism in the 5′-untranslated region of the gene is shown to lower the levles of GCL activity and GSH (glutathione), a major intracellular antioxidant. Therefore, it is associated with increased risk for lung and aerodigestive tract cancers.
Sequence
Synthetic peptide located within the following region: VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Sailendra N Nichenametla et al.
Molecular carcinogenesis, 52(10), 791-799 (2012-05-23)
Glutathione (GSH), the major intracellular antioxidant, protects against cancer development by detoxifying carcinogens and free radicals and strengthening the immune system. Recently, a GAG-trinucleotide repeat polymorphism in the 5'-untranslated region of the gene for the rate-limiting enzyme for GSH biosynthesis
Yunsheng Li et al.
Molecular reproduction and development, 89(10), 443-458 (2022-08-25)
MicroRNA21 (MIR21) abundance in porcine oocytes and cumulus cells increases during in vitro maturation. The mechanism by which MIR21 regulates oocyte maturation and the effect on the developmental competence of subsequent embryos remains unclear. The objective of this study was
Peng Han et al.
Oxidative medicine and cellular longevity, 2017, 7612182-7612182 (2018-02-13)
Acute kidney injury (AKI) induced by ischemia-reperfusion is a critical conundrum in many clinical settings. Here, this study aimed to determine whether and how RTA-408, a novel oleanane triterpenoid, could confer protection against renal ischemia-reperfusion injury (IRI) in male mice.
Danxin Wang et al.
BMC medical genomics, 5, 32-32 (2012-07-25)
Sulfamethoxazole (SMX) is a commonly used antibiotic for prevention of infectious diseases associated with HIV/AIDS and immune-compromised states. SMX-induced hypersensitivity is an idiosyncratic cutaneous drug reaction with genetic components. Here, we tested association of candidate genes involved in SMX bioactivation
Christophe Butticaz et al.
Free radical biology & medicine, 50(5), 617-623 (2010-12-16)
Glutamate cysteine ligase (GCL) catalyzes the rate-limiting step in the de novo synthesis of glutathione (GSH). The catalytic subunit (GCLC) of GCL contains a GAG trinucleotide-repeat (TNR) polymorphism within the 5'-untranslated region (5'-UTR) that has been associated with various human
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service
