Skip to Content
Merck
All Photos(9)

Key Documents

WH0026227M1

Sigma-Aldrich

Monoclonal Anti-PHGDH antibody produced in mouse

clone 4A3-1D6, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-3PGDH, Anti-MGC3017, Anti-PDG, Anti-PGAD, Anti-PGD, Anti-PGDH, Anti-SERA, Anti-phosphoglycerate dehydrogenase

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

4A3-1D6, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PHGDH(26227)

Related Categories

Immunogen

PHGDH (AAH11262.1, 1 a.a. ~ 533 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLVSDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF

Application

Monoclonal Anti-PHGDH antibody produced in mouse has been used in Western Blotting.

Biochem/physiol Actions

The gene PHGDH (D-3-phosphoglycerate dehydrogenase) is mapped to human chromosome 1p. The enzyme is mainly responsible for catalyzing initial step of the serine synthesis pathway, converting 3-phosphoglycerate into 3-phosphohydroxypyruvate. It is up-regulated in estrogen receptor-negative breast cancers, melanoma and cervical cancers. Mutations in the gene encoding PHGDH are associated with Neu-Laxova syndrome. Down-regulation in PHGDH levels results in congenital microcephaly, psychomotor retardation and seizures.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

p53 Protein-mediated regulation of phosphoglycerate dehydrogenase (PHGDH) is crucial for the apoptotic response upon serine starvation
Yang Ou
The Journal of Biological Chemistry, 290 (2014)
Neu-Laxova syndrome, an inborn error of serine metabolism, is caused by mutations in PHGDH
Ranad Shaheen
American Journal of Human Genetics, 94 (2014)
Molecular characterization of 3-phosphoglycerate dehydrogenase deficiency--a neurometabolic disorder associated with reduced L-serine biosynthesis
L W Klomp
American Journal of Human Genetics, 67 (2000)
Michael A Reid et al.
Nature communications, 9(1), 5442-5442 (2018-12-24)
Phosphoglycerate dehydrogenase (PHGDH) catalyzes the committed step in de novo serine biosynthesis. Paradoxically, PHGDH and serine synthesis are required in the presence of abundant environmental serine even when serine uptake exceeds the requirements for nucleotide synthesis. Here, we establish a
Rational Design of Selective Allosteric Inhibitors of PHGDH and Serine Synthesis with Anti-tumor Activity
Qian Wang
Cell Chemical Biology (2017)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service