Skip to Content
Merck
All Photos(6)

Key Documents

WH0051435M1

Sigma-Aldrich

Monoclonal Anti-SCARA3 antibody produced in mouse

clone 3A2, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-APC7, Anti-CSR, Anti-CSR1, Anti-MSLR1, Anti-MSRL1, Anti-scavenger receptor class A, member 3

Sign Into View Organizational & Contract Pricing

Select a Size

100 μG
$645.00

$645.00


Check Cart for Availability


Select a Size

Change View
100 μG
$645.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

$645.00


Check Cart for Availability

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3A2, monoclonal

form

buffered aqueous solution

species reactivity

rat, human, mouse

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SCARA3(51435)

General description

This gene encodes a macrophage scavenger receptor-like protein. This protein has been shown to deplete reactive oxygen species, and thus play an important role in protecting cells from oxidative stress. The expression of this gene is induced by oxidative stress. Alternatively spliced transcript variants encoding distinct isoforms have been described. (provided by RefSeq)

Immunogen

SCARA3 (NP_057324, 316 a.a. ~ 415 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SFLDDHEENMHDLQYHTHYAQNRTVERFESLEGRMASHEIEIGTIFTNINATDNHVHSMLKYLDDVRLSCTLGFHTHAEELYYLNKSVSIMLGTTDLLRE

Biochem/physiol Actions

Scavenger receptor class A member 3 (SCARA3) protects cells against ultraviolet (UV) irradiation and oxidative stress. Reduced expression of SCARA3 increases oxidative stress in keratoconus (KC) cells in vitro. Quantitative polymerase chain reaction (PCR) analysis proves that SCARA3 transcript is highly expressed in ovarian/primary peritoneal carcinoma (OC/PPC) compared to breast carcinoma effusions. SCARA3 represses tumor growth and metastasis of prostate cancer. Therefore, it can be used as a potential therapeutic target for treating aggressive types of prostate cancer.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

nwg

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Guoying Yu et al.
The American journal of pathology, 168(2), 597-607 (2006-01-27)
Prostate cancer is frequent among men over 45 years of age, but it generally only becomes lethal with metastasis. In this study, we identified a gene called cellular stress response 1 (CSR1) that was frequently down-regulated and methylated in prostate
Charles O Brown et al.
Leukemia research, 37(8), 963-969 (2013-03-30)
This study evaluates the role of scavenger receptor class A member 3 (SCARA3) in multiple myeloma (MM). SCARA3 expression was induced upon treatment with oxidative stressors (ionizing radiation and chemotherapeutic drugs). An epigenetic inactivation of SCARA3 was noted in MM.1S
Downregulation of SCARA3, CPSF3 and FOXM1 in Keratoconus Cells in vitro
CM Kenney
Investigative Ophthalmology & Visual Science, 53, 1112-1112 (2012)
H J Han et al.
Human molecular genetics, 7(6), 1039-1046 (1998-06-13)
Oxidative stress is a pathogenic condition that causes cellular damage and, in a normally functioning cell, several transcription factors respond to this threat by modulating expression of genes whose products ameliorate the altered redox status in some way. We have
Annika J Bock et al.
Human pathology, 43(5), 669-674 (2011-08-23)
Scavenger receptor class A, member 3 (SCARA3) was previously found to be overexpressed in ovarian/primary peritoneal carcinoma (OC/PPC) compared with breast carcinoma effusions by global gene expression analysis. The present study aimed to validate this finding applying quantitative PCR and

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service