Skip to Content
Merck
All Photos(2)

Key Documents

SAB2103083

Sigma-Aldrich

Anti-TRIM33 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-FLJ32925, Anti-PTC7, Anti-RFG7, Anti-TF1G, Anti-TIF1G

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
$629.00

$629.00


Check Cart for Availability


Select a Size

Change View
100 μL
$629.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

$629.00


Check Cart for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

122 kDa

species reactivity

guinea pig, bovine, rat, mouse, human, horse, rabbit, dog

concentration

0.5 mg - 1 mg/mL

technique(s)

immunofluorescence: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... TRIM33(51592)

Immunogen

Synthetic peptide directed towards the middle region of human TRIM33

Biochem/physiol Actions

TRIM33 is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region.The protein encoded by this gene is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Three alternatively spliced transcript variants for this gene have been described, however, the full-length nature of one variant has not been determined.

Sequence

Synthetic peptide located within the following region: EIYSDRTFAPLPEFEQEEDDGEVTEDSDEDFIQPRRKRLKSDERPVHIK

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service