SAB1408077

Anti-SYT16 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• Synonym(s): CHR14SYT, SYT14L, Strep14, syt14r, yt14r
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: antigen ~22.8 kDa
• species reactivity: human
• technique(s): western blot: 1 μg/mL
• NCBI accession no.: BC040924
• UniProt accession no.: Q17RD7
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SYT16(83851)

Description

General description

Mouse polyclonal antibody raised against a full-length human SYT16 protein.

SYT16 (synaptotagmin XVI) is a putative membrane trafficking protein belonging to the synaptotagmin (Syt) gene family. It is composed of a single N-terminal transmembrane domain and a putative fatty-acylation region adjacent to the transmembrane domain.

Immunogen

SYT16 (AAH40924.1, 1 a.a. ~ 203 a.a) full-length human protein.

Sequence
MTRERMMGEKLFYLSHLHPEGEMKVTLVLEPRSNISSGGSPLSPSAVSHSDSTSSTQSLSHGGAPELLVGLSYNATTGRLSVEMIKGSHFRNLAVNRAPDTYGKLFLLNSVGQEMSRCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLMISVYNRRTMKRKEMIGWIALGQNSSGEEEQDHWEEMKETKGQQICRWHTLLES

Application

Anti-SYT16 antibody produced in mouse is suitable for wstern blot analysis.

Biochem/physiol Actions

The activity of SYT16 (synaptotagmin XVI) is dependent on the Ca(2+) similar to all the members of Syt family proteins. It forms Ca(2+) independent oligomer. It may be involved in membrane and vesicular trafficking in specific tissues outside the brain.

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable