Skip to Content
Merck
All Photos(2)

Key Documents

HPA009083

Sigma-Aldrich

Anti-ICAM5 antibody produced in rabbit

Ab2, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-ICAM-5 antibody produced in rabbit, Anti-Intercellular adhesion molecule 5 precursor antibody produced in rabbit, Anti-Telencephalin antibody produced in rabbit

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
$1,040.00

$1,040.00


Check Cart for Availability


Select a Size

Change View
100 μL
$1,040.00

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

$1,040.00


Check Cart for Availability

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:50- 1:200

immunogen sequence

PPEMDESTCPSHQTWLEGAEASALACAARGRPSPGVRCSREGIPWPEQQRVSREDAGTYHCVATNAHGTDSRTVTVGVEYRPVVAELAASPPGGVRPGGNFTLTCR

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ICAM5(7087)

Looking for similar products? Visit Product Comparison Guide

General description

ICAM5 (intercellular adhesion molecule 5), also called telencephalin, is a neuronal cell adhesion molecule belonging to the ICAM family. This gene is localized to human chromosome 19p13.2 and spans 80kb. It is a glycoprotein, which is polarized towards the dendrites. This protein is composed of nine exoplasmic Ig (immunoglobulin) domain consisting of 832 amino acids. It is also composed of a transmembrane region of 28 amino acids, and a 64 amino acid-cytosolic region. It is exclusively expressed by neurons of telencephalon, which is the most rostral region of brain.

Immunogen

Intercellular adhesion molecule 5 precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

ICAM5 (intercellular adhesion molecule 5) shows hemophilic between neurons through binding between Ig (immunoglobulin) domain 1 to domain 4-5. It also interacts in a heterophilic manner with β2-integrins present on leukocytes. This proteinis involved in the arborization of hippocampal neurons and the outgrowth of dendrites. This protein interacts with LFA-1 (lymphocyte function-associated antigen-1) integrin present on microglia, which helps microglial spreading and regulates the function of microglia in both physiological and pathological conditions. Meta-analysis studies show that V301I and rs281439 polymorphisms in ICAM5 gene are responsible for susceptibility to breast cancer. This protein also functions as an anti-inflammatory agent in brain, where T-cell activation results in its cleavage from neurons.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71735

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

L Tian et al.
The Journal of cell biology, 150(1), 243-252 (2000-07-13)
Intercellular adhesion molecule-5 (ICAM-5) is a dendritically polarized membrane glycoprotein in telencephalic neurons, which shows heterophilic binding to leukocyte beta(2)-integrins. Here, we show that the human ICAM-5 protein interacts in a homophilic manner through the binding of the immunoglobulin domain
Lin Liu et al.
Molecular biology reports, 40(2), 1855-1860 (2012-10-20)
Intercellular cell adhesion molecules (ICAMs) genetic polymorphisms have been considered to be implicated in the development of breast cancer. However, the previous reports are conflicting. Therefore, we performed a meta-analysis to assess the association between three polymorphisms, including ICAM1 K469E
T Mizuno et al.
Brain research, 849(1-2), 58-66 (1999-12-11)
Telencephalin (TLCN) is a neuronal surface glycoprotein whose expression is restricted to the telencephalon, the most rostral segment of the brain. TLCN binds to lymphocyte function-associated antigen-1 (LFA-1) integrin. In the central nervous system, LFA-1 is selectively and constitutively expressed
P Kilgannon et al.
Genomics, 54(2), 328-330 (1998-11-26)
Intercellular adhesion molecule 5 (ICAM-5, telencephalin) is a cell adhesion molecule expressed on neurons in the most rostral segment of the mammalian brain, the telencephalon. Antibody studies in rodents and rabbits have demonstrated expression of this molecule on the cell
Li Tian et al.
Blood, 111(7), 3615-3625 (2008-01-29)
Intercellular adhesion molecules (ICAMs) bind to leukocyte beta2 integrins, which, among other functions, provide costimulatory signals for T-cell activation. ICAM-5 (telencephalin) is expressed in the somadendritic region of neurons of the mammalian brain. The receptor for ICAM-5 is the integrin

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service