Skip to Content
Merck
All Photos(2)

Key Documents

AV46385

Sigma-Aldrich

Anti-ST3GAL5 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-SIAT9, Anti-SIATGM3S, Anti-ST3 β-galactoside α-2,3-sialyltransferase 5, Anti-ST3GalV

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
$482.00

$482.00


Check Cart for Availability


Select a Size

Change View
100 μL
$482.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

$482.00


Check Cart for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

48 kDa

species reactivity

human, rabbit, horse, rat, pig, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ST3GAL5(8869)

Immunogen

Synthetic peptide directed towards the N terminal region of human ST3GAL5

Application

Anti-ST3GAL5 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml. It is also useful for immunohistochemistry at a concentration of 4-8μg/ml.

Biochem/physiol Actions

ST3GAL5 (ST3 beta-galactoside alpha-2,3-sialyltransferase 5) gene also known as SIAT9, SIATGM3S, ST3GalV or GM3 synthase encodes for a Golgi type II membrane protein belongs to the glycosyltransferase family 29. ST3GAL5 plays a crucial role in the formation of GM3 using lactosylceramide as the substrate. Loss of function mutation in the ST3GAL5, encoding GM3 synthase results in incapability to synthesize alpha and beta series of gangliosides that may cause infantile epilepsy syndrome.

Sequence

Synthetic peptide located within the following region: DSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Michael A Simpson et al.
Nature genetics, 36(11), 1225-1229 (2004-10-27)
We identified an autosomal recessive infantile-onset symptomatic epilepsy syndrome associated with developmental stagnation and blindness. Assuming a founder effect in a large Old Order Amish pedigree, we carried out a genome-wide screen for linkage and identified a single region of
M L Allende et al.
Glycobiology, 10(10), 1025-1032 (2000-10-13)
Ganglioside GM2 synthase and other enzymes required for complex ganglioside synthesis were localized recently to the trans Golgi network (TGN). However, there are conflicting reports as to the location of GM3 synthase; originally this enzyme was detected in the early

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service