Skip to Content
Merck
All Photos(1)

Documents

AV45417

Sigma-Aldrich

Anti-SMPD2 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-NSMASE, Anti-Sphingomyelin phosphodiesterase 2, neutral membrane (neutral sphingomyelinase)

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

48 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... SMPD2(6610)

Immunogen

Synthetic peptide directed towards the N terminal region of human SMPD2

Application

Anti-SMPD2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml.

Biochem/physiol Actions

Sphingomyelin phosphodiesterase 2, neutral membrane (SMPD2) is a sphingomyelin phosphodiesterase that hydrolyzes sphingomyelin to phosphocholine and ceramide. It is expressed mainly in neurons of central nervous system and is important in cell growth, differentiation, and apoptosis. SMPD2 is important in the regulation of late embryonic and postnatal development.

Sequence

Synthetic peptide located within the following region: RQKLSPTYPAAHHFRSGIIGSGLCVFSKHPIQELTQHIYTLNGYPYMIHH

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

R N Kolesnick et al.
Annual review of physiology, 60, 643-665 (1998-04-29)
Ceramide is a sphingosine-based lipid signaling molecule that regulates cellular differentiation, proliferation, and apoptosis. The emerging picture suggests that coupling of ceramide to specific signaling cascades is both stimulus and cell-type specific. Ceramide action is determined within the context of
Wilhelm Stoffel et al.
Proceedings of the National Academy of Sciences of the United States of America, 102(12), 4554-4559 (2005-03-15)
Neutral sphingomyelinases sphingomyelin phosphodiesterase (SMPD)2 and -3 hydrolyze sphingomyelin to phosphocholine and ceramide. smpd2 is expressed ubiquitously, and smpd3 is expressed predominantly in neurons of the CNS. Their activation and the functions of the released ceramides have been associated with
Akio Kihara et al.
Progress in lipid research, 46(2), 126-144 (2007-04-24)
Sphingolipids are major lipid constituents of the eukaryotic plasma membrane. Without certain sphingolipids, cells and/or embryos cannot survive, indicating that sphingolipids possess important physiological functions that are not substituted for by other lipids. One such role may be signaling. Recent

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service