Skip to Content
Merck
All Photos(2)

Key Documents

AV34471

Sigma-Aldrich

Anti-TFB2M (AB1) antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-FLJ22661, Anti-FLJ23182, Anti-Hkp1, Anti-Transcription factor B2, mitochondrial

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
$547.00

$547.00


Check Cart for Availability


Select a Size

Change View
100 μL
$547.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

$547.00


Check Cart for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

45 kDa

species reactivity

horse, human

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TFB2M(64216)

General description

TFB2M is a mitochondrial transcription factor that regulates the expression of SERCA2 gene in rat cardiomyocytes. It is also known to induce the transcription of human mtDNA.
Rabbit Anti-TFB2M (AB1) antibody recognizes human and rat TFB2M.

Immunogen

Synthetic peptide directed towards the N terminal region of human TFB2M

Application

Rabbit Anti-TFB2M (AB1) antibody is suitable for western blot (1.25 μg/ml) and IHC (4-8 μg/ml) applications.

Biochem/physiol Actions

TFB2M is a S-adenosyl-L-methionine-dependent methyltransferase which specifically dimethylates mitochondrial 12S rRNA at the conserved stem loop. It is also required for basal transcription of mitochondrial DNA, probably via its interaction with POLRMT and TFAM. It stimulates transcription independently of the methyltransferase activity. Compared to TFB1M, it activates transcription of mitochondrial DNA more efficiently, while it has less methyltransferase activity.

Sequence

Synthetic peptide located within the following region: ECNPGPGILTQALLEAGAKVVALESDKTFIPHLESLGKNLDGKLRVIHCD

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Maria Falkenberg et al.
Nature genetics, 31(3), 289-294 (2002-06-18)
Characterization of the basic transcription machinery of mammalian mitochondrial DNA (mtDNA) is of fundamental biological interest and may also lead to therapeutic interventions for human diseases associated with mitochondrial dysfunction. Here we report that mitochondrial transcription factors B1 (TFB1M) and
Atai Watanabe et al.
Cardiovascular research, 90(1), 57-67 (2010-11-30)
Sarco(endo)plasmic reticulum Ca²(+)-ATPase 2a (SERCA2a) transports Ca²(+) by consuming ATP produced by mitochondrial respiratory chain enzymes. Messenger RNA (mRNA) for these enzymes is transcribed by mitochondrial transcription factors A (TFAM) and B2 (TFB2M). This study examined whether TFAM and TFB2M

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service