WH0027242M8

Monoclonal Anti-TNFRSF21 antibody produced in mouse

clone 1B2, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-BM018, Anti-DR6, Anti-MGC31965, Anti-tumor necrosis factor receptor superfamily, member 21
• MDL number: MFCD02686099
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1B2, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect ELISA: suitable
• isotype: IgG2aκ
• GenBank accession no.: BC005192
• UniProt accession no.: O75509
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... TNFRSF21(27242)

Description

General description

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB and MAPK8/JNK, and induce cell apoptosis. Through its death domain, this receptor interacts with TRADD protein, which is known to serve as an adaptor that mediates signal transduction of TNF-receptors. Knockout studies in mice suggested that this gene plays a role in T-helper cell activation, and may be involved in inflammation and immune regulation. (provided by RefSeq)

Immunogen

TNFRSF21 (AAH05192.1, 1 a.a. ~ 124 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MQFNFELSFKYVLYSSYSWLKLDHTIADCMVFTWTPCRMLDYLYSSYANMLWAGEMKSSSHQDLLFKWLDNWATKELELHLLGFELFWNTLLHFGKSKSSASGALSIENLPSFALKDVLFFIYT

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Safety Information

• Storage Class Code: 10 - Combustible liquids
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable
• Personal Protective Equipment: dust mask type N95 (US), Eyeshields, Gloves