Skip to Content
Merck
All Photos(4)

Key Documents

WH0003673M1

Sigma-Aldrich

Monoclonal Anti-ITGA2 antibody produced in mouse

clone 2B6, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-BR, Anti-CD49B, Anti-GPIa, Anti-VLA2, Anti-VLAA2, Anti-integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor)

Sign Into View Organizational & Contract Pricing

Select a Size

100 μG
€418.00

€418.00


Ships within 2 weeks. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)


Select a Size

Change View
100 μG
€418.00

About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

€418.00


Ships within 2 weeks. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2B6, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ITGA2(3673)

General description

Integrin α2 (ITGA2) is a collagen receptor that is present on the platelets and epithelial cells. This protein is highly expressed in normal epithelial cells. The ITGA2 gene is located on the human chromosome at 5q11.2.

Immunogen

ITGA2 (NP_002194.2, 30 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
YNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLIL

Biochem/physiol Actions

Integrin α2 subunit (ITGA2) plays a role in angiogenesis, cell migration, invasion, and cell survival. This protein acts as a tumor activator in several tumors. ITGA2 protein might be involved in cell adhesion and cell-surface mediated signaling and is highly expressed in several cancers. Overexpression of the ITGA2 gene is observed in pancreatic ductal adenocarcinoma and ovarian cancer.
Integrin subunit α 2 (ITGA2) functions as a platelet receptor of collagen, which is an important activating agent required for platelet aggregation. Mutation in the gene might lead to aspirin insensitivity mainly in Chinese populations and in aspirin semi-resistance. Integrin α2β1 serves as a receptor for collagen and many other extracellular matrix (ECM) complexes. Variation in the gene elevates the expression of α2β1 on platelets and increase the risk of having melanoma, gastric, ovarian cancer, thrombosis, myocardial infarction and stroke. Thus, Integrin α2β1 acts as a potential therapeutic target for thrombosis related diseases, cancer, and inflammation. Cryptosporidium parvum infection, elevates the expression of ITGA2 in the host cell. Therefore, silencing the expression of the ITGA2 by using specific antibodies and the ligand type I collagen (collagen-I), is considered as a promising therapeutic method for treatment of cryptosporidial infection.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Integrin a2 (ITGA2)
Jyrki Heino
Encyclopedia of Signaling Molecules, 962-966 null
Liang Zhang et al.
Pathology oncology research : POR, 25(4), 1545-1552 (2018-12-06)
ITGA2 (Integrin alpha-2) has been detected to be over-expressed in a number of cancers and has been suggested to be involved in cell adhesion and cell-surface mediated signaling. Our previous study using bioinformatic analyses has shown that ITGA2 might be
Wen Ding et al.
PloS one, 10(8), e0135128-e0135128 (2015-08-11)
The loss of ITGA2 plays an important role in cancer metastasis in several solid cancers. However, the molecular mechanism of ITGA2 loss in primary cancers remains unclear. In this study, we found that a lower ITGA2 protein level was observed
Linlin Ma et al.
Aging, 12(6), 5336-5351 (2020-03-24)
Ovarian cancer is one of the most malignant tumors of the female reproductive system, with high invasiveness. The disease is a severe threat to women's health. The ITGA2 gene, which codes for integrin subunit α2, is involved in the proliferation
Xin-Yue Lian et al.
Journal of cellular physiology, 233(12), 9584-9593 (2018-08-23)
Previous studies have been indicated that integrin α2 (ITGA2) may be important in cell migration, invasion, survival, and angiogenesis. However, the correlation between ITGA2 expression and acute myeloid leukemia (AML) is still unclear. Real-time quantitative polymerase chain reaction was carried

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service