Skip to Content
Merck
All Photos(1)

Key Documents

SAB2108998

Sigma-Aldrich

Anti-CDKN1A (N-terminal) antibody produced in rabbit

affinity isolated antibody

Synonym(s):

CAP20, CDKN1, CIP1, MDA-6, P21

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
€387.00

€387.00


Ships within 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)


Select a Size

Change View
100 μL
€387.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

€387.00


Ships within 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

18 kDa

species reactivity (predicted by homology)

zebrafish, canine, rabbit, pig, mouse, guinea pig, bovine, horse, human, sheep

concentration

0.5 mg/mL

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): 4-8 μg/mL

NCBI accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CDKN1A(57396)

General description

This gene encodes a potent cyclin-dependent kinase inhibitor. The encoded protein binds to and inhibits the activity of cyclin-CDK2 or -CDK4 complexes, and thus functions as a regulator of cell cycle progression at G1. The expression of this gene is tightly controlled by the tumor suppressor protein p53, through which this protein mediates the p53-dependent cell cycle G1 phase arrest in response to a variety of stress stimuli. This protein can interact with proliferating cell nuclear antigen (PCNA), a DNA polymerase accessory factor, and plays a regulatory role in S phase DNA replication and DNA damage repair. This protein was reported to be specifically cleaved by CASP3-like caspases, which thus leads to a dramatic activation of CDK2, and may be instrumental in the execution of apoptosis following caspase activation. Multiple alternatively spliced variants have been found for this gene.

Immunogen

Synthetic peptide directed towards the N-terminal region of Human CDKN1A

Sequence

Synthetic peptide located within the following region: KACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLEGDFAW

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

nwg

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

If you need assistance, please contact Customer Support.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service