Skip to Content
Merck
All Photos(4)

Key Documents

HPA041436

Sigma-Aldrich

Anti-UBA2 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-ARX, Anti-FLJ13058, Anti-HRIHFB2115, Anti-SAE2

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
€544.00

€544.00


Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)


Select a Size

Change View
100 μL
€544.00

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

€544.00


Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

RNAi knockdown
Learn more about Antibody Enhanced Validation

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:1000-1:2500
western blot: 0.04-0.4 μg/mL

immunogen sequence

DFLQDYTLLINILHSEDLGKDVEFEVVGDAPEKVGPKQAEDAAKSITNGSDDGAQPSTSTAQEQDDVLIVDSDEEDSSNNAD

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... UBA2(10054)

General description

Ubiquitin-like modifier activating enzyme 2 (UBA2) is also known as small ubiquitin-like modifier (SUMO)-activating enzyme subunit 2 (SAE2). The UBA2 gene is present on human chromosome 19q13.11. It has three domains: an adenylation, catalytic and an ubiquitin-like domain.

Immunogen

ubiquitin-like modifier activating enzyme 2

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Ubiquitin-like modifier activating enzyme 2 (UBA2) participates in the sumoylation pathway. UBA2 mediated small ubiquitin-like modifier (SUMO) conjugation may play an important role in regulating the dynamics of cell cycle events. Deletion of UBA2 gene is associated with ectodermal and cutis aplasia. Microdeletion near the UBA2 gene locus is implicated in ectrodactyly ectodermal dysplasia‐clefting (EEC) syndrome.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST82619

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

19q13. 11 microdeletion: Clinical features overlapping ectrodactyly ectodermal dysplasia-clefting syndrome phenotype
Abe KT, et al.
Clinical case reports, 6(7), 1300-1307 (2018)
Structures of the SUMO E1 provide mechanistic insights into SUMO activation and E2 recruitment to E1
Lois LM and Lima CD
The Embo Journal, 24(3), 439-451 (2005)
Cutis Aplasia as a clinical hallmark for the syndrome associated with 19q13. 11 deletion: the possible role for UBA2 gene
Melo, et al.
Molecular Cytogenetics, 8(1), 21-21 (2015)
Identification of the enzyme required for activation of the small ubiquitin-like protein SUMO-1
Desterro J, et al.
The Journal of Biological Chemistry, 274(15), 10618-10624 (1999)
Carlos Venegas-Vega et al.
Molecular cytogenetics, 7(1), 61-61 (2014-12-18)
The 19q13.11 microdeletion syndrome (MIM613026) is a clinically recognisable condition in which a 324-kb minimal overlapping critical region has been recently described. However, genes not included within this region, such as WTIP and UBA2, have been proposed to contribute to

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service