Synthetic peptide directed towards the middle region of human GLYATL2
Application
Anti-GLYATL2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem/physiol Actions
Glycine-N-acyltransferase-like 2 (GLYATL2) is an enzyme associated with the endoplasmic reticulum and expressed in spinal cord, trachea, thyroid and salivary glands. This enzyme is involved in conjugation of the CoA ester of fatty acids to glycine.
Sequence
Synthetic peptide located within the following region: LDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNK
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
FASEB journal : official publication of the Federation of American Societies for Experimental Biology, 24(8), 2795-2803 (2010-03-23)
The discovery of glycine conjugates of long-chain fatty acids (N-acyl glycines) in the brain and other non-neuronal tissues has led to the identification of an emerging class of bioactive lipids. The biological activities of N-acyl glycines include antinociceptive, anti-inflammatory and
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.