Skip to Content
Merck
All Photos(1)

Key Documents

AV45470

Sigma-Aldrich

Anti-ZP2 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-ZPA, Anti-Zona pellucida glycoprotein 2 (sperm receptor)

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
€385.00

€385.00


Ships within 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)


Select a Size

Change View
100 μL
€385.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

€385.00


Ships within 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

68 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... ZP2(7783)

Immunogen

Synthetic peptide directed towards the C terminal region of human ZP2

Application

Anti-ZP2 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.

Biochem/physiol Actions

Zona pellucida glycoprotein 2 (ZP2; ZPA; sperm receptor) is a glycoprotein that is present in zona pellucida, the extracellular matrix that surrounds oocyte and the early embryo. ZP2 mediates the binding of the sperm to zona pellucida and its penetration.[1][2]

Sequence

Synthetic peptide located within the following region: PDSFPQWNVVVDGCAYDLDNYQTTFHPVGSSVTHPDHYQRFDMKAFAFVS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

F M Petit et al.
Human reproduction (Oxford, England), 28(4), 852-865 (2013-01-29)
Which human sperm proteins interact with zona pellucida (ZP) glycoproteins, ZPA/2, ZPB/4 and ZPC/3? Co-precipitation experiments with recombinant human ZP (rhZP) coated beads demonstrated interactions with various proteins, including glutathione S-transferase M3 (GSTM) with ZPB/4 and voltage-dependent anion channel 2
Boris Baibakov et al.
The Journal of cell biology, 197(7), 897-905 (2012-06-27)
Fertilization requires taxon-specific gamete recognition, and human sperm do not bind to zonae pellucidae (ZP1-3) surrounding mouse eggs. Using transgenesis to replace endogenous mouse proteins with human homologues, gain-of-function sperm-binding assays were established to evaluate human gamete recognition. Human sperm

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service