Skip to Content
Merck
All Photos(1)

Key Documents

AV38386

Sigma-Aldrich

Anti-NR5A2 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-B1F, Anti-B1F2, Anti-CPF, Anti-FTF, Anti-FTZ-F1, Anti-FTZ-F1beta, Anti-LRH-1, Anti-Nuclear receptor subfamily 5, group A, member 2

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
€385.00

€385.00


Ships within 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)


Select a Size

Change View
100 μL
€385.00

About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

€385.00


Ships within 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

61 kDa

species reactivity

human, sheep, bovine

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... NR5A2(2494)

General description

Nuclear receptor subfamily 5, group A, member 2 (NR5A2, BIF2, FTZ-F1β) is a transcription factor involved in cholesterol transport, bile acid homeostasis and steroidogenesis. Also known as liver receptor homolog-1, LRH-1 is expressed primarily in liver, intestine, exocrine pancreas, ovary and embryonic stem cells (ESC). LRH-1 regulates the expression of the key bile acid biosynthetic enzyme cholesterol 7α hydroxylase (Cyp7A1).

Specificity

Anti-NR5A2 polyclonal antibody reacts with human and bovine nuclear receptor subfamily 5, group A, member 2/ liver receptor homolog-1 proteins.

Immunogen

Synthetic peptide directed towards the N terminal region of human NR5A2

Application

Anti-NR5A2 polyclonal antibody is used to tag liver receptor homolog-1 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of liver receptor homolog-1 in the regulation of bile acid biosynthesis, cholesterol transport and steroidogenesis.

Biochem/physiol Actions

NR5A2 binds to the sequence element 5′-AACGACCGACCTTGAG-3′ of the enhancer II of hepatitis B virus genes, a critical cis-element of their expression and regulation. It may be responsable for the liver-specific activity of enhancer II, probably in combination with other hepatocyte transcription factors. It is a key regulator of cholesterol 7-alpha-hydroxylase gene (CYP7A) expression in liver. It may also contribute to the regulation of pancreas-specific genes and play important roles in embryonic development.

Sequence

Synthetic peptide located within the following region: MSSNSDTGDLQESLKHGLTPIVSQFKMVNYSYDEDLEELCPVCGDKVSGY

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service