MSST0015

SILu^™Prot B2M beta-2-microglobulin human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, ¹³C- and ¹⁵N-labeled

• Synonym(e): β-2-microglobulin
• NACRES: NA.12
• UNSPSC Code: 23201100
• Form: lyophilized powder
• Assay: ≥98% (SDS-PAGE)
• Biological source: human
• Recombinant: expressed in HEK 293 cells

Eigenschaften

• biological source: human
• Quality Segment: 200
• recombinant: expressed in HEK 293 cells
• assay: ≥98% (SDS-PAGE)
• form: lyophilized powder
• potency: ≥98% Heavy amino acids incorporation efficiency by MS
• technique(s): mass spectrometry (MS): suitable
• suitability: suitable for mass spectrometry (standard)
• UniProt accession no.: P61769
• storage temp.: −20°C
• Gene Information: human ... B2M(567)

Beschreibung

General description

SILu^™ Prot B2M is a recombinant, stable isotope-labeled human B2M which incorporates [¹³C₆, ¹⁵N₄]-Arginine and [¹³C₆, ¹⁵N₂]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of B2M in mass-spectrometry. SILu^™ Prot B2M is a monomer of 119 amino acids (including C-terminal polyhistidine and flag tags), with a molecular weight of ~14 kDa.
Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides)

Biochem/physiol Actions

B2M is the light chain of the major histocompatibility class (MHC) I molecule expressed on the cell surface of all nucleated cells. Increased urinary B2M excretion has been observed to be an early marker of tubular injury in a number of settings, including nephrotoxicant exposure, cardiac surgery, and renal transplantation, preceding rises in serum creatinine by as many as 4−5 days. B2M may also serve as an early biomarker for AKI (Acute Kidney Injury).

Physical form

Supplied as a lyophilized powder containing phosphate buffered saline.

Other Notes

IQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDMDYKDDDDKGHHHHHHHHGGQ

Legal Information

SILu is a trademark of Sigma-Aldrich Co. LLC

Sicherheitshinweise

• Lagerklasse: 11 - Combustible Solids
• wgk: WGK 2
• flash_point_f: Not applicable
• flash_point_c: Not applicable