AV50642

Anti-NRIP3 antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-C11orf14, Anti-NY-SAR-105, Anti-Nuclear receptor interacting protein 3
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: 1

Eigenschaften

• biological source: rabbit
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 27 kDa
• species reactivity: guinea pig, rabbit, mouse, rat, dog, human, horse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_065696
• UniProt accession no.: Q9NQ35
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... NRIP3(56675)

Beschreibung

General description

NRIP3 codes for nuclear receptor interacting protein 3. It may be involved in pediatric acute myeloid leukemia.
Rabbit Anti-NRIP3 antibody recognizes canine, bovine, human, mouse, and rat NRIP3.

Immunogen

Synthetic peptide directed towards the middle region of human NRIP3

Application

Rabbit Anti-NRIP3 antibody is suitable for western blot applications at a concentration of 0.5 μg/ml.

Biochem/physiol Actions

The exact functions of NRIP3 remain unknown.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: ALVDTGCLYNLISLACVDRLGLKEHVKSHKHEGEKLSLPRHLKVVGQIEH

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklasse: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable