AV48240

Anti-DRG1 antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-Developmentally regulated GTP binding protein 1
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: 1

Eigenschaften

• biological source: rabbit
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 26 kDa
• species reactivity: horse, human, rabbit, dog, guinea pig, rat, bovine, mouse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_004138
• UniProt accession no.: Q9Y295
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... DRG1(4733)

Beschreibung

General description

Developmentally regulated GTP binding protein 1 (DRG1) is a a guanine nucleotide binding protein that functions as a potassium-dependent GTPase. It is upregulated by Lerepo4.
Rabbit Anti-DRG1 antibody recognizes human, mouse, rat, bovine, zebrafish, chicken, and rabbit DRG1.

Immunogen

Synthetic peptide directed towards the middle region of human DRG1

Application

Rabbit Anti-DRG1 antibody is suitable for western blot applications at a concentration of 1μg/ml.

Biochem/physiol Actions

DRG1 belongs to the GTP1/OBG family.It may play a role in cell proliferation, differentiation and death.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: VLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSEL

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklasse: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable