AV48212

Anti-PEBP1 antibody produced in rabbit

IgG fraction of antiserum

• Synonym(e): Anti-HCNP, Anti-PBP, Anti-PEBP, Anti-Phosphatidylethanolamine binding protein 1, Anti-RKIP
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: IgG fraction of antiserum
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 21 kDa
• Speziesreaktivität: mouse, bovine, rat, guinea pig, horse, human, rabbit
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• NCBI-Hinterlegungsnummer: NP_002558
• UniProt-Hinterlegungsnummer: P30086
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... PEBP1(5037)

Beschreibung

Allgemeine Beschreibung

PEBP1 is a phosphatidylethanolamine binding protein that interacts with nucleotides and Raf-1 peptides. Studies in rat have revealed that PEBP1 is downregulated during hypoxia.
Rabbit Anti-PEBP1 antibody recognizes human, mouse, chicken, canine, bovine, and rabbit PEBP1.

Immunogen

Synthetic peptide directed towards the C terminal region of human PEBP1

Anwendung

Rabbit Anti-PEBP1 antibody is suitable for western blot applications at a concentration of 1.25μg/ml.

Biochem./physiol. Wirkung

PEBP1 binds ATP, opioids and phosphatidylethanolamine. It has lower affinity for phosphatidylinositol and phosphatidylcholine. It is also a serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase.

Sequenz

Synthetic peptide located within the following region: LSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable