AV46034

Anti-IFIT3 antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-CIG-49, Anti-GARG-49, Anti-IFI60, Anti-IFIT4, Anti-IRG2, Anti-ISG60, Anti-Interferon-induced protein with tetratricopeptide repeats 3, Anti-RIG-G
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: IHC, WB
• Citations: -

Eigenschaften

• biological source: rabbit
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 56 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable, western blot: suitable
• NCBI accession no.: NP_001540
• UniProt accession no.: O14879
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... IFIT3(3437)

Beschreibung

General description

Interferon-induced protein with tetratricopeptide repeats 3 (IFIT3) is an interferon-stimulated gene induced by RNA virus infections, lipopolysaccharides and double-stranded RNA. IFIT3 and its family members (IFIT1, IFIT2, IFIT5) are involved in protein:protein interactions the a effect processes such as translation initiation, virus replication, cell migration, proliferation and ds-RNA signaling.

Immunogen

Synthetic peptide directed towards the N terminal region of human IFIT3

Application

Anti-IFIT3 polyclonal antibody is used to tag interferon-induced protein with tetratricopeptide repeats 3 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and level of interferon-induced protein with tetratricopeptide repeats 3 in cells responding to interferon induction such as occurs during RNA virus infection.

Biochem/physiol Actions

Anti-IFIT3 polyclonal antibody reacts with human, mouse, bovine, and rat interferon-induced protein with tetratricopeptide repeats 3 proteins.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: ATMYNLLAYIKHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNY

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklasse: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable