AV45437

Anti-TAPBP antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-NGS17, Anti-TAP binding protein (tapasin), Anti-TAPA, Anti-TPN, Anti-TPSN
• UNSPSC-Code: 12352203
• NACRES: NA.41
• Klon: polyclonal
• application: IHC; WB
• Speziesreaktivität: human
• Methode(n): immunohistochemistry: suitable; western blot: suitable
• citations: 3

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 46 kDa
• Speziesreaktivität: human
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): immunohistochemistry: suitable; western blot: suitable
• NCBI-Hinterlegungsnummer: NP_003181
• UniProt-Hinterlegungsnummer: O15533
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Angaben zum Gen: human ... TAPBP(6892)

Beschreibung

Immunogen

Synthetic peptide directed towards the C terminal region of human TAPBP

Anwendung

Anti-TAPBP antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Biochem./physiol. Wirkung

TAP binding protein (TAPBP; tapasin) is a membrane glycoprotein that is involved in the transport of antigenic peptides across the endoplasmic membrane. The expression of tapasin is upregulated by potent inflammatory molecules such as eicosanoids.[1] Downregulation of tapasin expression is associated with clinical outcome in primary human oral squamous cell carcinoma.[2] Polymorphisms in TAPBP gene have been associated with the overall survival of colorectal cancer patients.[3]

Sequenz

Synthetic peptide located within the following region: GEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHS

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable