Synthetic peptide directed towards the middle region of human CACNB1
Biochem/physiol Actions
CACNB1 belongs to the calcium channel b subunit family. It has important roles in the modulation of calcium channels and calcium current, as well as in voltage-dependent activation and inactivation of calcium channels.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: TRRPTPPASGNEMTNLAFELDPLELEEEEAELGEQSGSAKTSVSSVTTPP
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.