APREST95400

PrEST Antigen TSPAN16

Prestige Antibodies^® Powered by Atlas Antibodies, buffered aqueous solution

• Synonym(e): TM-8, TM4-B, TM4SF16
• UNSPSC Code: 12352203
• Uniprot accession no.: Q9UKR8
• Species reactivity: -
• Application: —
• Citations: -

Eigenschaften

• recombinant: expressed in E. coli
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• assay: >80% (SDS-PAGE)
• form: buffered aqueous solution
• mol wt: predicted mol wt 22 kDa
• purified by: immobilized metal affinity chromatography (IMAC)
• concentration: ≥0.5 mg/mL
• sequence note: HTYPRSCCKSIGSVSCDGRDVSPNVIHQKGCFHKLLKITKTQS
• Ensembl | human accession no.: ENSG00000130167
• UniProt accession no.: Q9UKR8
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... TSPAN16(26526)

Beschreibung

General description

N-terminal His₆ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Application

Suitable as a blocking agent and positive assay control using corresponding antibodies.

Physical form

Solution in 1 M urea-PBS, pH 7.4

Preparation Note

Store at -20°C. Avoid repeated freeze/thaw cycles.

Other Notes

Corresponding Antibodies HPA076551

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Sicherheitshinweise

• Lagerklasse: 12 - Non Combustible Liquids
• Was ist los?: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable