Skip to Content
MilliporeSigma
All Photos(2)

Key Documents

WH0010912M1

Sigma-Aldrich

Monoclonal Anti-GADD45G antibody produced in mouse

clone 1D3, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-CR6, Anti-DDIT2, Anti-GADD45gamma, Anti-GRP17, Anti-growth arrest and DNA-damage-inducible, gamma

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1D3, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... GADD45G(10912)

General description

This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta. (provided by RefSeq)

Immunogen

GADD45G (AAH19325, 1 a.a. ~ 159 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE

Biochem/physiol Actions

GADD45G (growth arrest and DNA-damage-inducible, γ) gene encodes a protein that is expressed in increased levels under stress, growth arrest conditions and treatment with DNA-damaging agents such as UV (ultraviolet) and γ-irradiation. It mediates activation of MTK1/MEKK4 kinase (mitogen-activated protein kinase kinase kinase 4) upon environmental stress, which in turn activates p38 and JNK MAPK (c-Jun N-terminal kinase/ mitogen-activated protein kinase) pathways that regulate cell cycle and apoptosis. The encoded protein functions in DNA repair, negative growth control, genomic stability, cell cycle checkpoints and apoptosis.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

M Takekawa et al.
Cell, 95(4), 521-530 (1998-11-25)
The stress-responsive p38 and JNK MAPK pathways regulate cell cycle and apoptosis. A human MAPKKK, MTK1 (= MEKK4), mediates activation of both p38 and JNK in response to environmental stresses. Using a yeast two-hybrid method, three related proteins, GADD45alpha (=
Wenzheng Zhang et al.
Protein & cell, 2(10), 814-826 (2011-11-08)
The human Gadd45 protein family plays critical roles in DNA repair, negative growth control, genomic stability, cell cycle checkpoints and apoptosis. Here we report the crystal structure of human Gadd45γ [corrected], revealing a unique dimer formed via a bundle of

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service