Skip to Content
MilliporeSigma
All Photos(2)

Key Documents

HPA026441

Sigma-Aldrich

Anti-AKT3 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-PKB gamma, Anti-Protein kinase Akt-3, Anti-Protein kinase B, gamma, Anti-RAC-PK-gamma, Anti-RAC-gamma serine/threonine-protein kinase, Anti-STK-2

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000

immunogen sequence

EEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLL

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... AKT3(10000)

General description

AKT serine/threonine kinase 3 (AKT3) is part of the protein kinase B family. It has a kinase domain, a pleckstrin homology domain and a regulatory domain. The protein consists of 479 amino acids and the gene encoding it is localized on human chromosome 1q44.

Immunogen

RAC-gamma serine/threonine-protein kinase recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

AKT serine/threonine kinase 3 (AKT3) has a role in DNA repair and brain development. In mouse model, it modulates the expression of estrogen receptor α, Erb-B2 receptor tyrosine kinase 2 and Erb-B2 receptor tyrosine kinase 3 in breast cancer cells. AKT3 has been shown to stimulate the growth of triple-negative breast cancer.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST77824

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Phenotypes of AKT3 deletion: a case report and literature review.
Gai D
American Journal of Medical Genetics. Part A, 167A(1), 174-179 (2015)
Liesbeth C W Vredeveld et al.
Genes & development, 26(10), 1055-1069 (2012-05-03)
Human melanocytic nevi (moles) are benign lesions harboring activated oncogenes, including BRAF. Although this oncogene initially acts mitogenically, eventually, oncogene-induced senescence (OIS) ensues. Nevi can infrequently progress to melanomas, but the mechanistic relationship with OIS is unclear. We show here
Gillian O'Hurley et al.
Histopathology, 64(5), 660-670 (2013-10-22)
Triple-negative breast cancer (TNBC) is responsible for a disproportionate number of breast cancer (BC) deaths, owing to its intrinsic aggressiveness and a lack of treatment options, especially targeted therapies. Thus, there is an urgent need for the development of better
AKT3 regulates ErbB2, ErbB3 and estrogen receptor a expression and contributes to endocrine therapy resistance of ErbB2(+) breast tumor cells from Balb-neuT mice.
Grabinski N
Cellular Signalling, 26(5), 1021-1029 (2014)
Targeting Akt3 signaling in triple-negative breast cancer.
Chin YR
Cancer Research, 74(3), 964-973 (2014)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service