AV38768

Anti-DPF2 antibody produced in rabbit

IgG fraction of antiserum

• Synonym(s): Anti-D4, Zinc and double PHD fingers family 2
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 44 kDa
• species reactivity: bovine, rat, guinea pig, horse, rabbit, goat, dog, human, mouse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_006259
• UniProt accession no.: Q92785
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... DPF2(5977)

Description

Immunogen

Synthetic peptide directed towards the N terminal region of human DPF2

Biochem/physiol Actions

DPF2 is a d4 domain-containing transcription factor that is essential for apoptotic response in the absence of survival factors. It associates with histone H3 and HDAC1 and acts as nuclear-selective co-repressor of estrogen-related receptor alpha.

Sequence

Synthetic peptide located within the following region: MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQ

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable