Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

AV34529

Sigma-Aldrich

Anti-SMARCAD1 (AB2) antibody produced in rabbit

affinity isolated antibody

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

39 kDa

species reactivity

horse, human, dog

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

General description

SMARCAD1 is a SWI/SNF-related helicase that regulates heterochromatin organization and histone deacteylation. Studies in humans have reported that SMARCAD1 can enhance DNA end resection. SMARCAD1 mutation has been linked to autosomal-dominant adermatoglyphia.
Rabbit Anti-SMARCAD1 recognizes bovine, human, mouse, rat, and canine SMARCAD1.

Immunogen

Synthetic peptide directed towards the N terminal region of human SMARCAD1

Application

Rabbit Anti-SMARCAD1 is suitable for western blot applications at a concentration of 1 μg/ml.

Biochem/physiol Actions

SMARCAD1 belongs to the SNF2/RAD54 helicase family. It contains 2 CUE domains, 1 helicase ATP-binding domain, and 1 helicase C-terminal domain. It is a probable ATP-dependent DNA helicase.

Sequence

Synthetic peptide located within the following region: RANTPDSDITEKTEDSSVPETPDNERKASISYFKNQRGIQYIDLSSDSED

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Thomas Costelloe et al.
Nature, 489(7417), 581-584 (2012-09-11)
Several homology-dependent pathways can repair potentially lethal DNA double-strand breaks (DSBs). The first step common to all homologous recombination reactions is the 5'-3' degradation of DSB ends that yields the 3' single-stranded DNA required for the loading of checkpoint and
Janna Nousbeck et al.
American journal of human genetics, 89(2), 302-307 (2011-08-09)
Monogenic disorders offer unique opportunities for researchers to shed light upon fundamental physiological processes in humans. We investigated a large family affected with autosomal-dominant adermatoglyphia (absence of fingerprints) also known as the "immigration delay disease." Using linkage and haplotype analyses

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service