Saltar al contenido
Merck
Todas las fotos(7)

Documentos

WH0064399M1

Sigma-Aldrich

Monoclonal Anti-HHIP antibody produced in mouse

clone 5D11, purified immunoglobulin, buffered aqueous solution

Sinónimos:

Anti-FLJ20992, Anti-FLJ90230, Anti-HIP, Anti-hedgehog interacting protein

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

5D11, monoclonal

form

buffered aqueous solution

species reactivity

rat, human, mouse

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2bκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... HHIP(64399)

General description

This gene encodes a protein similar to the mouse hedgehog-interacting protein, a regulatory component of the hedgehog signalling pathway. Members of the hedgehog family are evolutionarily conserved proteins which are involved in many fundamental processes in embryonic development, including anteroposterior patterns of limbs and regulation of left-right asymmetry. (provided by RefSeq)

Immunogen

HHIP (NP_071920, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQ

Application

Monoclonal Anti-HHIP antibody produced in mouse has been used in immnohistochemistry.

Biochem/physiol Actions

The gene encoding HHIP (hedgehog interacting protein) is located on human chromosome 4, and encodes for a protein belonging to the hedgehog-interacting protein (HHIP) family. Hedgehog (HH) proteins are evolutionarily conserved proteins, and are important morphogens for a vast range of developmental processes, like regulation of left-right asymmetry and anteroposterior patterns of limbs during embryonic development. HH signals are regulated by numerous cell-surface receptors. HHIP encoded by this gene is highly conserved and interacts with all the three HH family members namely SHH (sonic hh), IHH (indian hh) and DHH (desert hh). It is also a vertebrate-specific inhibitor of HH signaling. Single nucleotide polymorphisms (SNPs) in HHIP gene is associated with increase in the risk of chronic obstructive pulmonary disease (COPD).

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

wgk_germany

nwg

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Association of HHIP polymorphisms with COPD and COPD-related phenotypes in a Chinese Han population.
Wang B
Gene (2013)
Hhip haploinsufficiency sensitizes mice to age-related emphysema
Taotao Lao
Proceedings of the National Academy of Sciences of the USA (2016)
Hedgehog signaling inhibition by the small molecule smoothened inhibitor GDC-0449 in the bone forming prostate cancer xenograft MDA PCa 118b.
Karlou M
Prostate (2012)
Gene expression analysis uncovers novel hedgehog interacting protein (HHIP) effects in human bronchial epithelial cells.
Zhou X
Genomics (2013)
Shh-mediated degradation of Hhip allows cell autonomous and non-cell autonomous Shh signalling.
Kwong L
Nature Communications (2014)

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico