WH0057019M1

Monoclonal Anti-CIAPIN1 antibody produced in mouse

clone 5G8, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-2810413N20Rik, Anti-Anamorsin, Anti-PRO0915, Anti-cytokine induced apoptosis inhibitor 1
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 5G8, monoclonal
• form: buffered aqueous solution
• species reactivity: human, rat, mouse
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG1λ
• GenBank accession no.: NM_020313
• UniProt accession no.: Q6FI81
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CIAPIN1(57019)

Descripción

General description

CIAPIN1 is a cytokine-induced inhibitor of apoptosis with no relation to apoptosis regulatory molecules of the BCL2 (MIM 151430) or CASP (see MIM 147678) families. Expression of CIAPIN1 is dependent on growth factor stimulation (Shibayama et al., 2004 [PubMed 14970183]).[supplied by OMIM

Immunogen

CIAPIN1 (NP_064709, 211 a.a. ~ 312 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: nwg
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)