WH0054567M4

Monoclonal Anti-DLL4 antibody produced in mouse

clone 2E2, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-MGC126344, Anti-delta-like 4 (Drosophila), Anti-hdelta2
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 2E2, monoclonal
• Formulario: buffered aqueous solution
• reactividad de especies: human
• técnicas: indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG2aκ
• Nº de acceso GenBank: NM_019074
• Nº de acceso UniProt: Q9NR61
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• Información sobre el gen: human ... DLL4(54567)

Descripción

Descripción general

This gene is a homolog of the Drosophila delta gene. The delta gene family encodes Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain. (provided by RefSeq)

Inmunógeno

DLL4 (NP_061947, 123 a.a. ~ 221 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HAPGDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPI

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): nwg
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)