Saltar al contenido
Merck
Todas las fotos(4)

Documentos clave

WH0010397M3

Sigma-Aldrich

Monoclonal Anti-NDRG1 antibody produced in mouse

clone 2D7, purified immunoglobulin, buffered aqueous solution

Sinónimos:

Anti-CAP43, Anti-CMT4D, Anti-DRG1, Anti-GC4, Anti-HMSNL, Anti-N-myc downstream regulated gene 1, Anti-NDR1, Anti-NMSL, Anti-PROXY1, Anti-RIT42, Anti-RTP, Anti-TARG1, Anti-TDD5

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Número MDL:
Código UNSPSC:
12352203
NACRES:
NA.41
En este momento no podemos mostrarle ni los precios ni la disponibilidad

origen biológico

mouse

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

2D7, monoclonal

Formulario

buffered aqueous solution

reactividad de especies

human

técnicas

immunofluorescence: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotipo

IgG2aκ

Nº de acceso GenBank

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... NDRG1(10397)

Descripción general

This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein involved in stress responses, hormone responses, cell growth, and differentiation. It is necessary for p53-mediated caspase activation and apoptosis. Mutation in this gene has been reported to be causative for hereditary motor and sensory neuropathy-Lom. Multiple alternatively spliced variants, encoding the same protein, have been identified. (provided by RefSeq)

Inmunógeno

NDRG1 (AAH03175, 1 a.a. ~ 394 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC

Aplicación

Monoclonal Anti-NDRG1 antibody produced in mouse has been used in immunohistochemistry and Western blotting.

Acciones bioquímicas o fisiológicas

NDRG1 (N-myc downstream regulated 1) is a Rab4a (Ras-related protein Rab-4A) effector protein associated with cell proliferation, differentiation, and invasion. It localizes at the perinuclear recycling/sorting vesicles of trans Golgi network. NDRG1 is essentially required for the p53-dependent apoptosis. At the site of DNA damage, its elevated expression identifies the target genes required for mediating apoptosis. It also plays a major role in the recycling and stabilization of adhesion molecule E-cadherin. In endosome recycling, NDRG1 interacts with the membrane bound Rab4aGTPase. Reports show that NDRG1 acts as a biomarker in the development of colorectal cancer (CRC).

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

N-myc downstream-regulated gene 1 downregulates cell proliferation, invasiveness, and tumorigenesis in human oral squamous cell carcinoma.
Jehn-Chuan Lee
Cancer Letters, 355 (2014)
N-myc downstream-regulated gene 1 promotes apoptosis in colorectal cancer via up-regulating death receptor 4
Oncotarget, 8(47), 82593?82608-82593?82608 (2017)
The metastasis suppressor, N-myc downregulated gene 1 (NDRG1), is a prognostic biomarker for human colorectal cancer
Zhihai Mao
PLoS ONE, 8 (2013)
Xian Zhang et al.
Oncotarget, 8(47), 82593-82608 (2017-11-16)
The aim of this study was to evaluate the clinical significance of N-myc downstream-regulated gene 1 (NDRG1) in colorectal cancer (CRC) patients and to explore the mechanisms governing the role of NDRG1 in apoptosis of CRC cells. In the current
Shunsuke Aoki et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 22(24), 10751-10760 (2002-12-18)
We developed a new method, designated N-linked glycosylation signal (NGS) differential display (DD)-PCR, that enables the identification of genes encoding N-linked glycosylated molecules that exhibit varying patterns of expression. Using this innovative technique, we identified an N-linked glycosylated 11-transmembrane domain

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico