WH0009221M2

Monoclonal Anti-NOLC1 antibody produced in mouse

clone 6B4, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-KIAA0035, Anti-NOPP130, Anti-NOPP140, Anti-NS5ATP13, Anti-P130, Anti-nucleolar and coiled-body phosphoprotein 1
• MDL number: MFCD01322248
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 6B4, monoclonal
• form: buffered aqueous solution
• species reactivity: human, mouse, rat
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG3κ
• GenBank accession no.: NM_004741
• UniProt accession no.: Q14978
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... NOLC1(9221)

Descripción

Immunogen

NOLC1 (NP_004732, 590 a.a. ~ 699 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EAAKEAETPQAKKIKLQTPNTFPKRKKGEKRASSPFRRVREEEIEVDSRVADNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQVNSIKFDSE

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Información de seguridad

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)