Saltar al contenido
Merck
Todas las fotos(2)

Documentos

WH0004586M7

Sigma-Aldrich

Monoclonal Anti-MUC5AC antibody produced in mouse

clone 2H7, purified immunoglobulin, buffered aqueous solution

Sinónimos:

Anti-MUC5, Anti-mucin 5, subtypes A and C, tracheobronchial/gastric

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2H7, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MUC5AC(4586)

General description

Mucin 5AC (MUC5AC) is encoded by the gene mapped to human chromosome 11p15.5 and is predominantly expressed in the gastric and tracheobronchial mucosae. The MUC5AC protein contains two types of deduced peptide domains such as eight amino acid tandemly repeated (TR) domains and cysteine-rich domains.

Immunogen

MUC5AC (XP_495860, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NQSTCAVYHRSLIIQQQGCSSSEPVRLAYCRGNCGDSSSMYSLEGNTVEHRCQCCQELRTSLRNVTLHCTDGSSRAFSYTEVEECGCMGRRCPAPGDTQH

Biochem/physiol Actions

Increased expression of Mucin 5AC (MUC5AC) leads to epithelial cancer progression, including colon cancer. Therefore, MUC5AC is considered to be a potential target in the treatment of colon cancer. MUC5AC containing the carbohydrate blood-group antigen, Lewis B (LeB) functions as a key receptor for Helicobacter pylori. O-glycoprotein encoded by the gene plays a vital role in mucus formation and epithelium protection. Decreased level of MUC5AC expression in ocular surface might lead to the tear instability in patients with SjÖgren syndrome.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

A E Biemer-Hüttmann et al.
The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society, 47(8), 1039-1048 (1999-07-29)
We studied the distribution of the four human apomucins MUC1, MUC2, MUC4, and MUC5AC in hyperplastic polyps, serrated adenomas, and traditional adenomas of the colorectum using immunohistochemical techniques, with the aim of comparing and contrasting their patterns of expression. A
Michaël Perrais et al.
The Journal of biological chemistry, 277(35), 32258-32267 (2002-06-22)
The 11p15 mucin genes (MUC2, MUC5AC, MUC5B and MUC6) possess a cell-specific pattern of expression in normal lung that is altered during carcinogenesis. Growth factors of the epidermal growth factor family are known to target key genes that in turn
Xijia Zhu et al.
Cancer biotherapy & radiopharmaceuticals, 31(7), 261-267 (2016-09-10)
Deregulated expressions of mucins have been found in various malignancies and play a pivotal role in carcinogenesis. MUC5AC, as a secreted mucin, is reported to be aberrantly expressed during epithelial cancer progression, including colon cancer. However, the mechanisms of the
Pablo Argüeso et al.
Investigative ophthalmology & visual science, 43(4), 1004-1011 (2002-03-30)
To determine whether the relative amounts of mucin mRNA in the conjunctival epithelium and mucin protein in the tears are altered in patients with Sjögren syndrome compared with healthy individuals. Tear fluid was collected from the inferior fornix of normal
Erica Kosmerl et al.
Nutrients, 16(7) (2024-04-13)
The goblet cells of the gastrointestinal tract (GIT) produce glycoproteins called mucins that form a protective barrier from digestive contents and external stimuli. Recent evidence suggests that the milk fat globule membrane (MFGM) and its milk phospholipid component (MPL) can

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico