WH0002119M2
Monoclonal Anti-ETV5 antibody produced in mouse
clone 7C10, purified immunoglobulin, buffered aqueous solution
Sinónimos:
Anti-ERM, Anti-ets variant gene 5 (ets-related molecule)
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
Productos recomendados
biological source
mouse
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
7C10, monoclonal
form
buffered aqueous solution
species reactivity
human, mouse, rat
technique(s)
indirect ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG1κ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... ETV5(2119)
General description
E-twenty-six (Ets) variant gene 5 (ETV5) protein belongs to the polyoma enhancer activator 3 (PEA3) subfamily of ETS transcription factors. The ETV5 gene is located on the human chromosome at 3q27.2.
Immunogen
ETV5 (NP_004445, 181 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPM
Sequence
LPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPM
Application
Monoclonal Anti-ETV5 antibody produced in mouse has been used in western blotting (1:1000).
Biochem/physiol Actions
E-twenty-six (Ets) variant gene 5 (ETV5) gene is responsible for the survival, proliferation, and self-renewal of spermatogonial stem cells (SSCs). ETV5 protein plays a role in mediating glial cell line-derived neurotrophic factor (GDNF) signaling and induces several genes required for regulating SSC fate. It is involved in limb development and regulates epithelial-mesenchymal transition in several cancer cells. ETV5 protein binds to the conserved GGAA/T motif and regulates gene expression.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Herramienta de selección de productos.
Storage Class
10 - Combustible liquids
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Certificados de análisis (COA)
Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Erik Melén et al.
The Journal of allergy and clinical immunology, 126(3), 631-637 (2010-09-08)
Epidemiologic studies consistently show associations between asthma and obesity. Shared genetics might account for this association. We sought to identify genetic variants associated with both asthma and obesity. On the basis of a literature search, we identified genes from (1)
Xin Wu et al.
Biology of reproduction, 85(6), 1114-1123 (2011-08-06)
Insight regarding mechanisms controlling gene expression in the spermatogonial stem cell (SSC) will improve our understanding of the processes regulating spermatogenesis and aid in treating problems associated with male infertility. In the present study, we explored the global gene expression
Lee Huang et al.
Cancer research, 81(8), 2071-2085 (2021-02-03)
The failure of once promising target-specific therapeutic strategies often arises from redundancies in gene expression pathways. Even with new melanoma treatments, many patients are not responsive or develop resistance, leading to disease progression in terms of growth and metastasis. We
Duy Pham et al.
The Journal of allergy and clinical immunology, 134(1), 204-214 (2014-02-04)
The differentiation of TH17 cells, which promote pulmonary inflammation, requires the cooperation of a network of transcription factors. We sought to define the role of Etv5, an Ets-family transcription factor, in TH17 cell development and function. TH17 development was examined
Severa Bunda et al.
Nature communications, 10(1), 661-661 (2019-02-10)
Capicua (CIC) is a transcriptional repressor that counteracts activation of genes downstream of receptor tyrosine kinase (RTK)/Ras/ERK signaling. It is well-established that tumorigenesis, especially in glioblastoma (GBM), is attributed to hyperactive RTK/Ras/ERK signaling. While CIC is mutated in other tumors
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico