Saltar al contenido
Merck
Todas las fotos(8)

Documentos clave

WH0002027M1

Sigma-Aldrich

Monoclonal Anti-ENO3 antibody produced in mouse

clone 5D1, purified immunoglobulin, buffered aqueous solution

Sinónimos:

Anti-MSE, Anti-enolase 3 (beta, muscle)

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Número MDL:
Código UNSPSC:
12352203
NACRES:
NA.41
En este momento no podemos mostrarle ni los precios ni la disponibilidad

origen biológico

mouse

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

5D1, monoclonal

Formulario

buffered aqueous solution

reactividad de especies

human

técnicas

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotipo

IgG2aκ

Nº de acceso GenBank

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

Información sobre el gen

human ... ENO3(2027)

Descripción general

ENO3 (enolase 3) gene codes for enolase enzyme. This isoenzyme is present in skeletal and cardiac muscle cells. This gene is located on human chromosome 17pter-p11 b.
This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in this gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme. Two transcripts have been identified for this gene that differ only in their 5′ UTR. (provided by RefSeq)

Inmunógeno

ENO3 (NP_001967, 228 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG

Acciones bioquímicas o fisiológicas

Mutations in ENO3 (enolase 3) is linked with metabolic myopathies that may occur due to decreased stability of the enzyme. It catalyses the interconversion of 2-phosphoglycerate and phosphoenolpyruvate. ENO3 possess several methylation properties.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

12 - Non Combustible Liquids

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Gene expression profile of rat left ventricles reveals persisting changes following chronic mild exercise protocol: implications for cardioprotection
Giusti B, et al.
BMC Genomics (2009)
Methylation patterns in the human muscle-specific enolase gene (ENO3)
Peshavaria M and Day IN
The Biochemical Journal (1993)
The implications of human metabolic network topology for disease comorbidity
Lee DS, et al.
Proceedings of the National Academy of Sciences of the USA, 105(29), 9880-9885 (2008)
Characterization of porcine ENO3: genomic and cDNA structure, polymorphism and expression
Wu J, et al.
Genetics, Selection, Evolution : GSE, 40(5), 563-579 (2008)

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico