SAB5702882

Anti-PKC delta Antibody, clone 7I5U6, Rabbit Monoclonal

• Sinónimos: ALPS3, CVID9, MAY1, PKCD, nPKC-delta
• UNSPSC Code: 12352203
• NACRES: NA.46

Propiedades

• biological source: rabbit
• Quality Level: 100
• material: colorless
• clone: 7I5U6, monoclonal
• form: liquid
• mol wt: 78 kDa
• species reactivity: rat, rat, human
• concentration: 1.33 mg/mL
• technique(s): immunofluorescence: 1:50 - 1:200; immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:2000
• color: colorless
• isotype: IgG
• immunogen sequence: PFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLID
• UniProt accession no.: Q05655
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... PRKCD(5580)

Descripción

General description

Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play distinct roles in cells. The protein encoded by this gene is one of the PKC family members. Studies both in human and mice demonstrate that this kinase is involved in B cell signaling and in the regulation of growth, apoptosis, and differentiation of a variety of cell types. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq, Jul 2008]

Immunogen

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 547-653 of human PKC delta (Q05655).

Application

WB, IHC, IF/ICC

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1