We tested this antibody using 1 ug/ml and 2 ug/ml concentration in western blot and it did not work for protein extracted from human cells (HepG2), mouse cells (AML12) and male & female C57BL/6 mice liver. We used GAPDH as loading control and it worked perfectly, giving clear bands in those samples. However, no band was detected for USP30 using this antibody even at 2 ug/ml i.e 1:250 dilution of the antibody. This is a complete waste of money and the product should have been well validated before sale.
SAB2109073
Anti-USP30 antibody produced in rabbit
Anti-USP30 antibody produced in rabbit
1 of 1 reviewers received a sample product or took part in a promotion
affinity isolated antibody
Sinónimos:
FLJ40511, MGC10702
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Seleccione un Tamaño
100 μL
US$ 525,00
US$ 525,00
Envío en 5 días laborables. (Para pedidos fuera de Estados Unidos, calcule la entrega 1 o 2 semanas más tarde)
Seleccione un Tamaño
Cambiar Vistas
100 μL
US$ 525,00
About This Item
UNSPSC Code:
12352203
NACRES:
NA.43
US$ 525,00
Envío en 5 días laborables. (Para pedidos fuera de Estados Unidos, calcule la entrega 1 o 2 semanas más tarde)
Productos recomendados
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
57 kDa
species reactivity (predicted by homology)
canine, rabbit, horse, human, bovine, rat, guinea pig, mouse
concentration
0.5 mg/mL
technique(s)
western blot: 1 μg/mL
NCBI accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... USP30(57396)
General description
USP30, a member of the ubiquitin-specific protease family (see USP1, MIM 603478), is a novel mitochondrial deubiquitinating (DUB) enzyme (Nakamura and Hirose, 2008 [PubMed 18287522]).
Immunogen
Synthetic peptide directed towards the middle region of human USP30
Sequence
Synthetic peptide located within the following region: SCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQPRVTHLFDVH
Physical form
Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Storage Class
10 - Combustible liquids
wgk_germany
nwg
flash_point_f
Not applicable
flash_point_c
Not applicable
Elija entre una de las versiones más recientes:
Certificados de análisis (COA)
Lot/Batch Number
Lo sentimos, en este momento no disponemos de COAs para este producto en línea.
Si necesita más asistencia, póngase en contacto con Atención al cliente
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Active Filters
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico
