Free fatty acid receptor 1 (FFAR1) formerly known as G-protein coupled receptor 40 (GPR 40) is predominantly expressed in pancreatic beta cells. In human chromosome, the gene FFAR1 is located on 19q13.12.
Inmunógeno
Synthetic peptide directed towards the N terminal region of human FFAR1
Acciones bioquímicas o fisiológicas
Free fatty acid receptor 1 (FFAR1) is activated by binding of medium or long chain free fatty acids. It increases the Ca2+ level intracellularly through phospholipase C mediated signalling and that potentially stimulates insulin production. FFAR1 is a potential drug target for metabolic diseases like type 2 diabetes.
Secuencia
Synthetic peptide located within the following region: KVSEAALSLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLV
Forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Free fatty acid receptors FFAR1 and GPR120 as novel therapeutic targets for metabolic disorders
Hara T, et al.
Journal of Pharmaceutical Sciences, 100(9), 3594-3601 (2011)
Re-evaluation of fatty acid receptor 1 (FFAR1/GPR40) as drug target for the stimulation of insulin secretion in humans
Wagner R, et al.
Diabetes, DB_121249-DB_121249 (2013)
Free fatty acids regulate insulin secretion from pancreatic beta cells through GPR40
Itoh Y, et al.
Nature, 422(6928), 173-176 (2003)
Questions
Reviews
★★★★★ No rating value
Active Filters
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.