Synthetic peptide directed towards the middle region of human Nobox
Acciones bioquímicas o fisiológicas
Nobox is a transcription factor which plays an essential role in postnatal follicle development.Nobox binds preferentially to the DNA sequences 5′-TAATTG-3′, 5′-TAGTTG-3′ and 5′-TAATTA-3′. Directly regulates the transcription of POU5F1 aand GDF9 during early folliculogenesis.
Secuencia
Synthetic peptide located within the following region: ETKNGPAAPSADSSQHRSAPELLDPMPTDLEPGPVPPENILDVFPEPPML
Forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Journal of ovarian research, 17(1), 18-18 (2024-01-15)
The ovarian environment of premature ovarian insufficiency (POI) patients exhibits immune dysregulation, which leads to excessive secretion of numerous proinflammatory cytokines that affect ovarian function. An abnormal level of macrophage polarization directly or indirectly inhibits the differentiation of ovarian granulosa
Questions
Reviews
★★★★★ No rating value
Active Filters
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
