Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

SAB2104121

Sigma-Aldrich

Anti-CHAC2, (N-terminal) antibody produced in rabbit

affinity isolated antibody

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41
En este momento no podemos mostrarle ni los precios ni la disponibilidad

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

21 kDa

reactividad de especies

guinea pig, human, mouse, dog, rat, rabbit, bovine

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... CHAC2(494143)

Descripción general

Glutathione-specific γ-glutamylcyclotransferase 2 (ChaC2) belongs to the ChaC family of γ-glutamylcyclotransferases.[1] It carries a methionine (Met) residue at the N-terminus.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human CHAC2

Aplicación

Anti-CHAC2, (N-terminal) antibody produced in rabbit has been used in western blot.[1]

Acciones bioquímicas o fisiológicas

Glutathione-specific γ-glutamylcyclotransferase 2 (ChaC2) helps in degrading glutathione in the cytosol of mammals.[1] In pathways that are independent of ChaC1, ChaC2 would disrupt the expression of nuclear erythroid-2-like factor (Nrf2) and glutamate cysteine ligase. Upregulation of ChaC2 gene can prevent the proliferation of cells. It may be considered as a candidate tumor suppressor gene (TSG) in gastrointestinal cancer.

Secuencia

Synthetic peptide located within the following region: MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVV

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Yen T K Nguyen et al.
Biomolecules, 10(1) (2019-12-28)
Glutathione (GSH) degradation plays an essential role in GSH homeostasis, which regulates cell survival, especially in cancer cells. Among human GSH degradation enzymes, the ChaC2 enzyme acts on GSH to form 5-l-oxoproline and Cys-Gly specifically in the cytosol. Here, we
Shuiping Liu et al.
Cell death & disease, 8(8), e3009-e3009 (2017-08-25)
Tumor suppressor genes play a key role in cancer pathogenesis. Through massive expression profiling we identified CHAC2 as a frequently downregulated gene in gastric and colorectal cancers. Immunohistochemistry and western blot revealed that CHAC2 was downregulated in most tumor tissues
Amandeep Kaur et al.
The Journal of biological chemistry, 292(2), 638-651 (2016-12-04)
Glutathione degradation plays an important role in glutathione and redox homeostasis, and thus it is imperative to understand the enzymes and the mechanisms involved in glutathione degradation in detail. We describe here ChaC2, a member of the ChaC family of

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico