SAB1413292

Monoclonal Anti-CLDN6 antibody produced in mouse

clone 1P8, purified immunoglobulin, buffered aqueous solution

• Sinónimos: CLDN6
• Código UNSPSC: 51111800

Propiedades

• conjugado: unconjugated
• Nivel de calidad: 100
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 1P8, monoclonal
• Formulario: buffered aqueous solution
• mol peso: 23.3 kDa
• reactividad de especies: human
• concentración: ~0.3-1 μg/μL (Please refer to lot specific concentration)
• técnicas: ELISA: suitable
• isotipo: IgG2b, kappa
• Nº de acceso Protein ID: NM_021195.3
• Condiciones de envío: dry ice
• temp. de almacenamiento: -10 to -25°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... CLDN6(9074)

Descripción

Descripción general

Mouse monoclonal antibody raised against a full-length recombinant CLDN6.

Inmunógeno

CLDN6 (NP_067018.1, 1 a.a. ~ 220 a.a) full-length recombinant protein with GST tag.

Secuencia

MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAVIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV

Forma física

Solution in phosphate buffered saline, pH 7.4

Nota de preparación

Purification by Protein A sepharose

Almacenamiento y estabilidad

Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 2
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable