SAB1412228

ANTI-TSC22D4 antibody produced in mouse

clone 1C12, purified immunoglobulin, buffered aqueous solution

• Sinónimos: THG-1, THG1, TSC22D4
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1C12, monoclonal
• form: buffered aqueous solution
• mol wt: antigen 68.97 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• isotype: IgG1κ
• NCBI accession no.: BC001966
• UniProt accession no.: Q9Y3Q8
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... TSC22D4(81628)

Descripción

General description

TGF-β-stimulated clone-22 (TSC22) domain family member 4 (TSC22D4) is encoded by the gene mapped to human chromosome 7q22.1. The encoded protein belongs to the TSC22 protein family.

TSC22D4 is a member of the TSC22 domain family of leucine zipper transcriptional regulators (see TSC22D3; MIM 300506) (Kester et al., 1999 [PubMed 10488076]; Fiorenza et al., 2001 [PubMed 11707329]).[supplied by OMIM

Immunogen

TSC22D4 (AAH01966, 1 a.a. ~ 395 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSGGKKKSSFQITSVTTDYEGPGSPGASDPPTPQPPTGPPPRLPNGEPSPDPGGKGTPRNGSPPPGAPSSRFRVVKLPHGLGEPYRRGRWTCVDVYERDLEPHSFGGLLEGIRGASGGAGGRSLDSRLELASLGLGAPTPPSGLSQGPTSWLRPPPTSPGPQARSFTGGLGQLVVPSKAKAEKPPLSASSPQQRPPEPETGESAGTSRAATPLPSLRVEAEAGGSGARTPPLSRRKAVDMRLRMELGAPEEMGQVPPLDSRPSSPALYFTHDASLVHKSPDPFGAVAAQKFSLAHSMLAISGHLDSDDDSGSGSLVGIDNKIEQAMDLVKSHLMFAVREEVEVLKEQIRELAERNAALEQENGLLRALASPEQLAQLPSSGVPRLGPPAPNGPSV

Biochem/physiol Actions

TGF-β-stimulated clone-22 (TSC22) acts as a tumor suppressor. It plays a vital role in systemic glucose metabolism. TSC22D4 inhibition might be an insulin sensitizing route in diabetes treatment. Elevated expression of the gene has been observed in non-small cell lung cancer (NSCLC) patients. Aberrations in the expression of the gene resulted in significant metabolic effects.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable