SAB1409921
Anti-LY6D antibody produced in mouse
purified immunoglobulin, buffered aqueous solution
Sinónimos:
E48
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
En este momento no podemos mostrarle ni los precios ni la disponibilidad
Productos recomendados
origen biológico
mouse
conjugado
unconjugated
forma del anticuerpo
purified immunoglobulin
tipo de anticuerpo
primary antibodies
clon
polyclonal
Formulario
buffered aqueous solution
mol peso
antigen 13.3 kDa
reactividad de especies
human
técnicas
western blot: 1 μg/mL
Nº de acceso NCBI
Nº de acceso UniProt
Condiciones de envío
dry ice
temp. de almacenamiento
−20°C
modificación del objetivo postraduccional
unmodified
Información sobre el gen
human ... LY6D(8581)
Descripción general
The gene LY6D (lymphocyte antigen 6 complex, locus D) is mapped to human chromosome 8q24.3. It belongs to the LY6 (lymphocyte antigen 6) gene family. The encoded protein is a membrane protein with molecular weight of 14kDa. It is a glycosyl phosphatidylinositol (GPI)-anchored protein.
Inmunógeno
LY6D (NP_003686.1, 1 a.a. ~ 128 a.a) full-length human protein.
Sequence
MRTALLLLAALAVATGPALTLRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPSYTLQGQVSSGTSSTQCCQEDLCNEKLHNAAPTRTALAHSALSLGLALSLLAVILAPSL
Sequence
MRTALLLLAALAVATGPALTLRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPSYTLQGQVSSGTSSTQCCQEDLCNEKLHNAAPTRTALAHSALSLGLALSLLAVILAPSL
Acciones bioquímicas o fisiológicas
LY6D (lymphocyte antigen 6 complex, locus D) is required for discriminating B lineage restricted common lymphoid progenitors. It is upregulated by X-ray irradiation-mediated DNA damage pathway controlled via ATM (ataxia telangiectasia mutated), CHK2 (checkpoint kinase 2) and p53. LY6D is upregulated in various cancers and is associated with patient survival outcome.
Forma física
Solution in phosphate buffered saline, pH 7.4
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Código de clase de almacenamiento
10 - Combustible liquids
Clase de riesgo para el agua (WGK)
WGK 3
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Elija entre una de las versiones más recientes:
Certificados de análisis (COA)
Lot/Batch Number
¿No ve la versión correcta?
Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Qingzhao Zhang et al.
PloS one, 8(8), e72397-e72397 (2013-09-12)
Common lymphoid progenitors (CLPs) are thought to represent major intermediates in the transition of hematopoietic stem cells (HSCs) to B lineage lymphocytes. However, it has been obvious for some time that CLPs are heterogeneous, and there has been controversy concerning
Maiko Kurosawa et al.
The FEBS journal, 279(24), 4479-4491 (2012-10-19)
In order to identify membrane proteins whose expression is induced by X-ray irradiation, we developed an antibody (Ab)-directed strategy using a phage Ab library. X-Ray-irradiated cells were screened with a phage Ab library in the presence of a large excess
Jie Hu et al.
American journal of medical genetics. Part A, 167A(8), 1921-1926 (2015-04-14)
A 7-year-old female with developmental delay (DD), autism spectrum disorder (ASD), intellectual disability (ID), attention deficit hyperactivity disorder (ADHD), and seizures was referred to our laboratory for oligomicroarray analysis. The analysis revealed a 540 kb microdeletion in the chromosome 8q24.3 region
Linlin Luo et al.
Oncotarget, 7(10), 11165-11193 (2016-02-11)
Stem cell antigen-1 (Sca-1) is used to isolate and characterize tumor initiating cell populations from tumors of various murine models [1]. Sca-1 induced disruption of TGF-β signaling is required in vivo tumorigenesis in breast cancer models [2, 3-5]. The role
Active Filters
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico
