SAB1404444

Monoclonal Anti-TBX2, (C-terminal) antibody produced in mouse

clone 3B2, ascites fluid

• Sinónimos: FLJ10169
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: ascites fluid
• tipo de anticuerpo: primary antibodies
• clon: 3B2, monoclonal
• mol peso: antigen ~37.11 kDa
• reactividad de especies: human
• técnicas: indirect ELISA: suitable; western blot: 1:500-1:1000
• isotipo: IgG2aκ
• Nº de acceso NCBI: NM_005994
• Nº de acceso UniProt: Q13207
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... TBX2(6909)

Descripción

Descripción general

This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene product is the human homolog of mouse Tbx2, and shares strong sequence similarity with Drosophila omb protein. Expression studies indicate that this gene may have a potential role in tumorigenesis as an immortalizing agent. Transcript heterogeneity due to alternative polyadenylation has been noted for this gene. (provided by RefSeq)

Inmunógeno

TBX2 (NP_005985, 603 a.a. ~ 702 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GSARPRLRFSPYQIPVTIPPSTSLLTTGLASEGSKAAGGNSREPSPLPELALRKVGAPSRGALSPSGSAKEAANELQSIQRLVSGLESQRALSPGRESPK

Forma física

Clear solution

Información de seguridad

• Código de clase de almacenamiento: 11 - Combustible Solids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable