Saltar al contenido
Merck
Todas las fotos(3)

Documentos clave

SAB1404387

Sigma-Aldrich

Anti-β-Synuclein (SNCB) Antibody

mouse monoclonal, 3G6

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41
En este momento no podemos mostrarle ni los precios ni la disponibilidad

Nombre del producto

Monoclonal Anti-SNCB antibody produced in mouse, clone 3G6, purified immunoglobulin, buffered aqueous solution

origen biológico

mouse

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

3G6, monoclonal

Formulario

buffered aqueous solution

mol peso

antigen ~40.85 kDa

reactividad de especies

human

técnicas

capture ELISA: suitable
immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotipo

IgG2aκ

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... SNCB(6620)

Descripción general

β-Synuclein (SNCB) is present in the presynaptic neuron terminal. It comprises an imperfect KTKEGV sequence at the N-terminus as well as highly acidic and intrinsically disordered regions. SNCB shares sequence similarity with α-synuclein. The SNCB gene is mapped to human chromosome 5q35.2.

Inmunógeno

SNCB (AAH02902, 1 a.a. ~ 134 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA

Acciones bioquímicas o fisiológicas

β-Synuclein (SNCB) may delay the α- synuclein (αS) fibril formation and inhibit its aggregation. SNCB and αS interact with lipid vesicles to form a high degree of α-helical structure. SNCB is implicated in Dementia with Lewy bodies (DLB), a neurodegenerative dementia.

Forma física

Solution in phosphate buffered saline, pH 7.4

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

James W P Brown et al.
Scientific reports, 6, 36010-36010 (2016-11-04)
α-Synuclein is an intrinsically disordered protein that is associated with the pathogenesis of Parkinson's disease through the processes involved in the formation of amyloid fibrils. α and β-synuclein are homologous proteins found at comparable levels in presynaptic terminals but β-synuclein
Andres Jerez et al.
Journal of clinical oncology : official journal of the American Society of Clinical Oncology, 30(12), 1343-1349 (2012-03-01)
Interstitial deletions of chromosome 5q are common in acute myeloid leukemia (AML) and myelodysplastic syndromes (MDS), pointing toward the pathogenic role of this region in disease phenotype and clonal evolution. The higher level of resolution of single-nucleotide polymorphism array (SNP-A)
Tracey Evans et al.
Brain research, 1681, 1-13 (2017-12-27)
Dementia with Lewy bodies (DLB) is the second most prevalent neurodegenerative dementia, where an accumulation of aggregated fibrillar alpha-synuclein in neurons of limbic and forebrain regions of the brain leads to visual hallucination, cognitive impairment of a fluctuating nature and
Gina M Moriarty et al.
The Journal of biological chemistry, 292(39), 16368-16379 (2017-07-16)
α-Synuclein (αS) is the primary protein associated with Parkinson's disease, and it undergoes aggregation from its intrinsically disordered monomeric form to a cross-β fibrillar form. The closely related homolog β-synuclein (βS) is essentially fibril-resistant under cytoplasmic physiological conditions. Toxic gain-of-function

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico