SAB1403883

Monoclonal Anti-GRID1 antibody produced in mouse

clone 3A8, purified immunoglobulin, buffered aqueous solution

• Sinónimos: KIAA1220
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3A8, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~36.34 kDa
• species reactivity: human
• technique(s): capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2bκ
• NCBI accession no.: NM_017551
• UniProt accession no.: Q9ULK0
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... GRID1(2894)

Descripción

General description

This gene encodes a subunit of glutamate receptor channels. These channels mediate most of the fast excitatory synaptic transmission in the central nervous system and play key roles in synaptic plasticity

Immunogen

GRID1 (NP_060021, 349 a.a. ~ 441 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LNCIRKSTKPWNGGRSMLDTIKKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKGLNGSLQERPMGSRLQGLTLKV

Physical form

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable