SAB1403506

Monoclonal Anti-MAP3K15 antibody produced in mouse

clone 1H7, purified immunoglobulin, buffered aqueous solution

• Sinónimos: FLJ16518, bA723P2.3
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 1H7, monoclonal
• Formulario: buffered aqueous solution
• mol peso: antigen ~36.67 kDa
• reactividad de especies: human
• técnicas: capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG2bκ
• Nº de acceso NCBI: NM_001001671
• Nº de acceso UniProt: Q6ZN16
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... MAP3K15(389840)

Descripción

Descripción general

Mitogen-activated protein kinase kinase kinase 15 (MAP3K15) belongs to the group of apoptosis signal-regulating kinases. It is expressed in the kidney and the gene encoding it is localized on human chromosome Xp22.12.

Inmunógeno

MAP3K15 (NP_001001671, 691 a.a. ~ 786 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRLQGADAKTIEKIVEEGYTLSDILNEITKEDLRYLRLRGGLLCRLWSAVSQYRRAQEASETKD

Acciones bioquímicas o fisiológicas

Mitogen-activated protein kinase kinase kinase 15 (MAP3K15) modulates blood pressure in the kidney. It has a role in signal transduction cascades related to apoptotic cell death initiated due to cellular stress. ASK3 has been shown to protect HeLa cells against cytotoxicity induced by oxidative stress, antibodies or proteins.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable